PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g14200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 114aa    MW: 13106.1 Da    PI: 9.4845
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g14200.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-183986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
   Vang02g14200.1 39 KGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYL 86
                     79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-243289IPR009057Homeodomain-like
PROSITE profilePS5129423.4343490IPR017930Myb domain
SMARTSM007178.6E-133888IPR001005SANT/Myb domain
PfamPF002493.1E-163986IPR001005SANT/Myb domain
SuperFamilySSF466893.42E-2140113IPR009057Homeodomain-like
CDDcd001675.35E-104186No hitNo description
Gene3DG3DSA:1.10.10.601.6E-690113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MISTSSLLLL FSLSYVYMYN IMDKKPCNST SSHDPEVRKG PWTMEEDLIL INYIANHGEG  60
VWNSLAKASG LKRTGKSCRL RWLNYLRPDV RRGNITTEEQ LLIFELHSKW GNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-173411322100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-113AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151019.11e-67hypothetical protein PHAVU_004G012000g
SwissprotP813917e-56MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0S3T7U92e-79A0A0S3T7U9_PHAAN; Uncharacterized protein
STRINGGLYMA05G08690.18e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.12e-51myb domain protein 24